PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_19360V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 534aa    MW: 58510.7 Da    PI: 7.8375
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_19360V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-161360148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W +eEde+l ++v+ +G+g+W+++ ++ g+ R++k+c++rw +yl
  Pp3c3_19360V3.2.p 13 KGAWAAEEDEKLRKYVETYGTGHWRSVGKKAGLQRCGKSCRLRWTNYL 60
                       799*******************************************97 PP

2Myb_DNA-binding57.23.7e-1867109246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        g++T+eE+ l+v++++ +G++ W++Ia+ m+ gRt++++k++w++
  Pp3c3_19360V3.2.p  67 GSFTQEEENLIVKLHAAHGSR-WSLIAAQMP-GRTDNDIKNHWNT 109
                        78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.917860IPR017930Myb domain
SuperFamilySSF466899.9E-3011107IPR009057Homeodomain-like
SMARTSM007176.2E-131262IPR001005SANT/Myb domain
PfamPF002491.3E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-231467IPR009057Homeodomain-like
CDDcd001677.11E-111560No hitNo description
PROSITE profilePS5129427.73661115IPR017930Myb domain
SMARTSM007171.9E-1665113IPR001005SANT/Myb domain
PfamPF002492.3E-1667109IPR001005SANT/Myb domain
CDDcd001671.06E-1268111No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2668115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MTRLLKSNED VRKGAWAAEE DEKLRKYVET YGTGHWRSVG KKAGLQRCGK SCRLRWTNYL  60
RPDIRHGSFT QEEENLIVKL HAAHGSRWSL IAAQMPGRTD NDIKNHWNTR LKKKLCDLGI  120
DPVTHKPIAD LLRDLAGTIA NSSGTGNQVA EEAARRCFRD NLVSKAVREC GKAKPALASQ  180
YMLHKSLNDV HRRDVQGTED LTMSELHAGD IVQKSSNNSG SHSMDESSST EEALSRRSNS  240
PPDSIDFEHL NQHRYQASTG DHHQSDIEQR TAGTVVESSC GRIAYLSLAQ MNEANMSGFM  300
GARSSALPSF QEVDQVGCSL PASSLPNAGS DQFDYRNTDF GKVINVFRSN APISDSPTRP  360
VVQQRADGTR WSASRSALSQ DAHLPISPSC AASQLPLSRF SSEVHNQLAQ SHAEVSYMQG  420
SDLSRPQSTS APSKLDVRIN LGYNQQRPLP ESFGYRNFSG PSTTSSTSTP GSVLDMTTQQ  480
TLPGYGGQYS SSSSATNANH TSFNSPLAGT PTGLRLHECE VPSPRMVLWD FQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28101154108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S204_13V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.16e-60myb domain protein 103